PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_011734-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family ZF-HD
Protein Properties Length: 356aa    MW: 38405.2 Da    PI: 9.1085
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_011734-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer109.12.4e-34134189359
    ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                    +vrY+eClkNhAas+Ggh+vDGCgEfmps geegt++alkCaAC+CHRnFHR+++e 
  NNU_011734-RA 134 GVRYRECLKNHAASIGGHVVDGCGEFMPS-GEEGTPEALKCAACDCHRNFHRKDMEG 189
                    79**************************9.999********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.2E-31135187IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-22135188IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.2E-31136186IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.524137186IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.57E-20285353IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.4E-31291354IPR009057Homeodomain-like
TIGRFAMsTIGR015657.7E-28292348IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MELRGQDKER GMPSSLVYNP PIRESSSKVS SSHSVISTGL VGVGERRKDG TGNGTAILNP  60
SQTLDHLQHQ HLHLHHHQPQ GQGRTPDPPE PDPVPVAVAV GGATGAPVAG GSNSRTPPSA  120
PTTTVSTIPR TATGVRYREC LKNHAASIGG HVVDGCGEFM PSGEEGTPEA LKCAACDCHR  180
NFHRKDMEGE PQSGANCYYY YNKNHGGCGG RSRIPPPPPQ LPPQPLQQHQ KFQLGLPTSP  240
STGPIPPPMM MAFCSGGVGG GATESSSEDL NVYQSNAAGG ATRPLPPFSL SKKRFRTKFT  300
QEQKDRMLEF AEKVGWRIQK QDEPEVQQFC AEVGVKRQVL KVWMHNNKHS AKKKQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-262913511676ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00238DAPTransfer from AT1G75240Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010263641.10.0PREDICTED: zinc-finger homeodomain protein 5
SwissprotQ9FRL53e-65ZHD5_ARATH; Zinc-finger homeodomain protein 5
TrEMBLV4UHS41e-104V4UHS4_9R
STRINGPOPTR_0007s12970.11e-95(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.13e-60homeobox protein 24